Skip to main content

Table 3 Overview of Lactobacillus crispatus strain-specific growth on glycogen and corresponding translated amino acid sequence at the N-terminal of a pullulanase type I gene

From: Comparative genomics of human Lactobacillus crispatus isolates reveals genes for glycosylation and glycogen degradation: implications for in vivo dominance of the vaginal microbiota

Strain ID Group Growth on glycogen Pullulanase type I amino acid sequence (N-terminal)
RL3 LVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL5 LVM M________NKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAP_____________________________________PQNVPTVLAA
RL6 LVM +/− M_____________________________SLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL8 LVM NA MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL9 LVM +/− M_____________________________SLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL10 LVM NA MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL11 LVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL16 LVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL22† LVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL26 LVM +/− M_____________________________SLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL27 LVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL29 LVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL32 LVM NC ---------------------------------------------------------------------------------------------------
RL2 DVM +/− M_____________________________SLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL7 DVM +/− M_____________________________SLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL13 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL14 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL15 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL17 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL19 DVM EL M_____________________________SLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL20 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL21 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL23 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL24 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL25 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL28 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL30 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
RL31 DVM NC ---------------------------------------------------------------------------------------------------
RL33 DVM + MILWRNLFMNKKSGHNIKFKSIFVCTSAIMSLWLGANLTTTQVHAAEDNAAPKSSEVVGQTNSSKDNAATATVQNQSNAKAKQRQQGVAPQNVPTVLAA
  1. LVM Lactobacillus-dominated vaginal microbiota, DVM dysbiotic vaginal microbiota, NA not available, NC non-cultivable, EL extended lag time
  2. †The genome of RL22 was not deposited in GenBank as the sequencing depth was too low and the N50 and NG50 values gave an inconclusive image of the assembly’s quality